Protein Info for CA264_19215 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: RNA polymerase subunit sigma

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 197 PF04542: Sigma70_r2" amino acids 26 to 88 (63 residues), 58.9 bits, see alignment E=6.8e-20 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 27 to 186 (160 residues), 93.4 bits, see alignment E=5.9e-31 PF07638: Sigma70_ECF" amino acids 123 to 187 (65 residues), 22.7 bits, see alignment E=1.7e-08 PF08281: Sigma70_r4_2" amino acids 131 to 181 (51 residues), 60.4 bits, see alignment E=2.2e-20 PF04545: Sigma70_r4" amino acids 135 to 184 (50 residues), 44.2 bits, see alignment E=2.1e-15

Best Hits

Swiss-Prot: 44% identical to SIGH_MYCBO: ECF RNA polymerase sigma factor SigH (sigH) from Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 73% identity to chu:CHU_0601)

Predicted SEED Role

"RNA polymerase sigma-70 factor, ECF subfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWX3 at UniProt or InterPro

Protein Sequence (197 amino acids)

>CA264_19215 RNA polymerase subunit sigma (Pontibacter actiniarum KMM 6156, DSM 19842)
MSEQTGKQLSKEEKDARFEAELLPVLDPLYNFAYRLTLDEDDANDLVQETYLKAYRFFDY
FEQGTNAKAWLFRILKNSFINEFRKKSKQPAKVDYSEVEGYYNSEDVEGESGVASTTDMR
TESVQDLIGDEVASALNALPVDFRTVIILCDLEGFTYEEMAKILDIPIGTVRSRLHRARN
SLKEKLEKYAKGMGYNS