Protein Info for CA264_19185 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: adenosylhomocysteinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 435 PF05221: AdoHcyase" amino acids 7 to 144 (138 residues), 245.5 bits, see alignment E=1.7e-76 amino acids 145 to 434 (290 residues), 213.5 bits, see alignment E=1e-66 TIGR00936: adenosylhomocysteinase" amino acids 8 to 427 (420 residues), 646.8 bits, see alignment E=6.9e-199 PF00670: AdoHcyase_NAD" amino acids 194 to 355 (162 residues), 259.5 bits, see alignment E=3.4e-81 PF02826: 2-Hacid_dh_C" amino acids 213 to 303 (91 residues), 34 bits, see alignment E=4.8e-12 PF13241: NAD_binding_7" amino acids 214 to 305 (92 residues), 23.6 bits, see alignment E=1.6e-08 PF07991: IlvN" amino acids 215 to 279 (65 residues), 28.2 bits, see alignment E=3.4e-10

Best Hits

Swiss-Prot: 80% identical to SAHH_GRAFK: Adenosylhomocysteinase (ahcY) from Gramella forsetii (strain KT0803)

KEGG orthology group: K01251, adenosylhomocysteinase [EC: 3.3.1.1] (inferred from 86% identity to psn:Pedsa_3593)

MetaCyc: 68% identical to Adenosylhomocysteinase (Homo sapiens)
ADENOSYLHOMOCYSTEINASE-RXN [EC: 3.13.2.1]

Predicted SEED Role

"Adenosylhomocysteinase (EC 3.3.1.1)" in subsystem Methionine Biosynthesis or Methionine Degradation (EC 3.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.13.2.1 or 3.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YX34 at UniProt or InterPro

Protein Sequence (435 amino acids)

>CA264_19185 adenosylhomocysteinase (Pontibacter actiniarum KMM 6156, DSM 19842)
MVETYLKYKVRDISLADWGRKEIRLAEAEMPGLMAIREEFGPSKPLKGARIAGCLHMTIQ
TAVLIETLVELGAEVTWSSCNIFSTQDHAAAAIAAAGISVYAWKGMTAEEFDWCIEQTLF
FGEDRQPLNMILDDGGDLTNMVLDKYPELSAGIKGLSEETTTGVHRLYERMKNGTLTMPA
INVNDSVTKSKFDNKYGCKESLVDAIRRATDVMMAGKVAVVAGYGDVGKGSAASLRGAGA
RVIVTEIDPICALQAAMDGFAVKRMVDAVKEADIVVTATGNKDIIGEQEFRSMKDKTIVC
NIGHFDNEIDMAWLNKTYGNTKDVIKPQVDLYNIDGKDIIVLAEGRLVNLGCATGHPSFV
MSNSFSNQTLAQLELWTNTEAYENKVYTLPKHLDEKVARLHLSKIGVELDELSPDQASYI
GVEVEGPYKPEYYRY