Protein Info for CA264_19110 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: excinuclease ABC subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 675 TIGR00631: excinuclease ABC subunit B" amino acids 3 to 667 (665 residues), 1020.3 bits, see alignment E=0 PF04851: ResIII" amino acids 10 to 90 (81 residues), 49.6 bits, see alignment E=1.4e-16 PF17757: UvrB_inter" amino acids 158 to 247 (90 residues), 98.7 bits, see alignment E=5.1e-32 PF00271: Helicase_C" amino acids 430 to 543 (114 residues), 70 bits, see alignment E=6e-23 PF12344: UvrB" amino acids 550 to 590 (41 residues), 80.8 bits, see alignment 1.5e-26 PF02151: UVR" amino acids 634 to 668 (35 residues), 32.5 bits, see alignment (E = 1.6e-11)

Best Hits

Swiss-Prot: 69% identical to UVRB_CYTH3: UvrABC system protein B (uvrB) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03702, excinuclease ABC subunit B (inferred from 73% identity to sli:Slin_3612)

MetaCyc: 58% identical to UvrABC excision nuclease subunit B (Escherichia coli K-12 substr. MG1655)
3.1.25.-

Predicted SEED Role

"Excinuclease ABC subunit B" in subsystem DNA repair, UvrABC system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWW2 at UniProt or InterPro

Protein Sequence (675 amino acids)

>CA264_19110 excinuclease ABC subunit B (Pontibacter actiniarum KMM 6156, DSM 19842)
MDFKLTSEFQPTGDQPKAIAQLTEGINKGEPSQVLLGATGTGKTFTMANVIKNTGKPTLV
LCHNKTLAAQLYGEFKQFFPDNAVEYFISYYDYYQPEAYIASNDVFIEKDMAINEEIEKL
RLHTTSALLSGRRDVVVVASVSCIYGIGNPEEFGKNVLYLAPGQRYSRNNLLYTFVQILY
SRTEAEFTRGTFRVKGDTVDIFPAYADFAYRLYFFGDELEAIHRIDPESGKKLSDEKAVT
LYPANLFVTGKETLNQAIHEIQYDMVAQHEYFLKEDRPTEAKRIKERTEFDLEMIRELGY
CSGIENYSRYFDRRAPGSRPFCLLDYFPDDFLMVIDESHVTVPQVRAMWGGDRSRKVALV
EYGFRLPAAMDNRPLTFNEFESLMHQVVFVSATPGDYEIQKSEGVIVEQIIRPTGLLDPE
IEIRPSTNQVDDLLDEIDERVKEGARVLVTTLTKRMSEELAKYLERLNIKVKYLHSEVKT
LDRVEILRELRLGVIDVLIGVNLLREGLDLPEVSLVAILDADKEGFLRDQRSLIQTMGRA
ARNEKGKVIMYADRMTDSMQRAIDETNRRRATQMAYNEEHGIVPRTILKTSDEIHGQTSV
ADSKKKEVKMYTGPEEVSIAAEPIIQTMKRDELEKLIKKTEKQMEAAAKDLDFLQAAKYR
DELADLRKLLKSKRD