Protein Info for CA264_19070 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DUF368 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 56 to 79 (24 residues), see Phobius details amino acids 85 to 101 (17 residues), see Phobius details amino acids 108 to 127 (20 residues), see Phobius details amino acids 138 to 167 (30 residues), see Phobius details amino acids 179 to 202 (24 residues), see Phobius details amino acids 213 to 226 (14 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details PF04018: DUF368" amino acids 1 to 245 (245 residues), 348.6 bits, see alignment E=1e-108

Best Hits

KEGG orthology group: K08974, putative membrane protein (inferred from 62% identity to cts:Ctha_1490)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYR9 at UniProt or InterPro

Protein Sequence (299 amino acids)

>CA264_19070 DUF368 domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MGAADVVPGVSGGTIAFITGIYEELLGSIRSVNGEALKLLLRFDLKGFWKHINGNFLVVL
ISGILFSIASLSRLILYLLENHPEMLWSFFFGLIVASAVVVSKKITRWTPGVLLAGLAGA
AIAYYITVATPTQSPEAYWFIFLSGAIAICAMILPGISGSFLLVLLAKYEFILNAVKELR
VDIVAVFGVGCVTGILAFSHVLNYMLKRHHNVTVALLTGFMVGSLNKVWPWKQTLETYTD
RHGEVKPLVQENVLPGSYEALTGQEPYLMYGILLAVFGFMLVYFVDRITDDTTTPQVKV