Protein Info for CA264_19065 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphosulfolactate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 257 PF02679: ComA" amino acids 9 to 245 (237 residues), 310.5 bits, see alignment E=4e-97

Best Hits

Swiss-Prot: 41% identical to PSLS_BACSU: Phosphosulfolactate synthase (yitD) from Bacillus subtilis (strain 168)

KEGG orthology group: K08097, phosphosulfolactate synthase [EC: 4.4.1.19] (inferred from 80% identity to sli:Slin_0707)

Predicted SEED Role

"Phosphosulfolactate synthase (EC 4.4.1.19)" (EC 4.4.1.19)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.4.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWM2 at UniProt or InterPro

Protein Sequence (257 amino acids)

>CA264_19065 phosphosulfolactate synthase (Pontibacter actiniarum KMM 6156, DSM 19842)
MNYTLNSIPERATKPRERGFTMAMDKGLSIREVEDFLEVAGDYVDIVKLGWATSFVTPNL
KKKLEVYRAAGIPTYFGGTLFEAFIVRNQFDDYRRVLDQYEMTFAEVSDGSLEMAHDEKC
EYIAKLSEQVTVLSEVGSKDAEKIIPPYMWIKLMKAELEAGAWKVIGEAREGGNVGLFRS
TGEVRSGLVEEILTQIPFEKILWEAPQKAQQVWFIKLLGANVNLGNIAPSEVIPLETIRL
GLRGDTFSHFLDMEKPC