Protein Info for CA264_19060 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 465 PF14559: TPR_19" amino acids 44 to 103 (60 residues), 27.4 bits, see alignment E=3.3e-09 PF13432: TPR_16" amino acids 71 to 128 (58 residues), 27 bits, see alignment 5e-09 amino acids 105 to 159 (55 residues), 20.1 bits, see alignment 7.3e-07 amino acids 191 to 233 (43 residues), 17.9 bits, see alignment 3.6e-06 amino acids 285 to 337 (53 residues), 23.8 bits, see alignment 5e-08 amino acids 317 to 371 (55 residues), 16.7 bits, see alignment 8.6e-06 PF13181: TPR_8" amino acids 101 to 130 (30 residues), 12.5 bits, see alignment (E = 0.00014) amino acids 135 to 167 (33 residues), 31.8 bits, see alignment (E = 8.9e-11) amino acids 204 to 226 (23 residues), 19.8 bits, see alignment (E = 6.4e-07) amino acids 237 to 261 (25 residues), 13.8 bits, see alignment (E = 5.4e-05) amino acids 270 to 302 (33 residues), 17.1 bits, see alignment (E = 4.5e-06) amino acids 305 to 336 (32 residues), 14.1 bits, see alignment (E = 4.2e-05) PF13424: TPR_12" amino acids 101 to 165 (65 residues), 30.5 bits, see alignment E=3.2e-10 PF13176: TPR_7" amino acids 107 to 135 (29 residues), 18 bits, see alignment (E = 2.3e-06) amino acids 204 to 225 (22 residues), 14.4 bits, see alignment (E = 3.2e-05) PF00515: TPR_1" amino acids 135 to 167 (33 residues), 29.7 bits, see alignment (E = 3.9e-10) amino acids 203 to 235 (33 residues), 34.1 bits, see alignment (E = 1.6e-11) PF13431: TPR_17" amino acids 190 to 222 (33 residues), 24.7 bits, see alignment (E = 1.8e-08) PF13174: TPR_6" amino acids 204 to 226 (23 residues), 12.4 bits, see alignment (E = 0.0002) amino acids 305 to 336 (32 residues), 12.4 bits, see alignment (E = 0.00021) PF13414: TPR_11" amino acids 209 to 247 (39 residues), 31.4 bits, see alignment 1.1e-10 PF07719: TPR_2" amino acids 270 to 302 (33 residues), 23.1 bits, see alignment (E = 5.1e-08) amino acids 305 to 336 (32 residues), 23.5 bits, see alignment (E = 4e-08)

Best Hits

KEGG orthology group: None (inferred from 42% identity to mtt:Ftrac_2675)

Predicted SEED Role

"TPR repeat containing protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWT9 at UniProt or InterPro

Protein Sequence (465 amino acids)

>CA264_19060 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKEDFDEHSEELELIQRFERMLGNNETAFFDLTDFEYIIDHYTANFEYKKALAACDSALV
QYPFSTELQIDKAQLLAMSGNFEGALELINKVAEVEPENADVQLTRGIVYTQRGEFRAAI
DYFKKALAYADDRDDIYFNIGLAYQTWGKVASAIKYYKKCVELNQENEAAMQEVLYCMDL
TNSVNEHLPFFQKFVDDDPYSYVAWFNLGNVYNKMGAYDKAIAAYDYATIIRPDFITAYN
NMANAQVYLGEYTKAIESFNAMIEHGEPNAEVYCNIGECYEKLLQWDLSRRYYQKSVDLD
PEMDEAWFGIGVILDAQGKWYEAVHFFKKAVELYNDSADYWVALAAAEYHVGHVVSALES
YERAAEIRPDDKNIYLNWSIILFEQGNFEEATDIILNAIELQPKEAELYYRACAYMLSAG
KYREAYNYLENALILDFDKHKLLFEFFPELESQRALARLIDQYRK