Protein Info for CA264_19045 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF02771: Acyl-CoA_dh_N" amino acids 6 to 118 (113 residues), 142.9 bits, see alignment E=1.1e-45 PF02770: Acyl-CoA_dh_M" amino acids 123 to 217 (95 residues), 85.5 bits, see alignment E=4.5e-28 PF00441: Acyl-CoA_dh_1" amino acids 229 to 378 (150 residues), 176 bits, see alignment E=1.2e-55 PF08028: Acyl-CoA_dh_2" amino acids 244 to 361 (118 residues), 90.2 bits, see alignment E=2.8e-29

Best Hits

Swiss-Prot: 53% identical to ACDA_BACSU: Acyl-CoA dehydrogenase (acdA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 80% identity to mtt:Ftrac_2408)

MetaCyc: 50% identical to Bcd (Clostridium acetobutylicum ATCC 824)

Predicted SEED Role

"Butyryl-CoA dehydrogenase (EC 1.3.99.2)" in subsystem Acetyl-CoA fermentation to Butyrate or Anaerobic respiratory reductases or Butanol Biosynthesis or Isobutyryl-CoA to Propionyl-CoA Module or Isoleucine degradation or Valine degradation (EC 1.3.99.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.2

Use Curated BLAST to search for 1.3.99.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWP5 at UniProt or InterPro

Protein Sequence (379 amino acids)

>CA264_19045 acyl-CoA dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MELKTTENQRMIADMVRDFGAKHIKPQMREWDESQEFPVEVFKKLGELGLMGVLVPTEYG
GSGFGYLEYVTAIAELARIDGSIGLSMAAHNSLCTGHILQFGNEEQKKKYLPKLATAEWI
GAWGLTEPNTGSDAGNMRTVAVQDGDYYVINGAKNFITHGKSGNVAVVIVRTGEVGDSHG
MTAFVIEKGTPGFSAGRKEDKLGMRASETTELIFQDCRVHKDQILGEVGEGFVQAMKVLD
GGRISIAALSLGIAQGALDAALAYSQERQQFNKPISSFQGIAFKLADMATEVEAASLLTY
QAADMKNRGLNVNKESAMAKLFASEVSVRVANEAVQIFGGYGFTKDYPAEKYYRDAKLCT
IGEGTSEIQKLVISRAMLK