Protein Info for CA264_18860 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TIGR00374 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 353 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 45 to 68 (24 residues), see Phobius details amino acids 87 to 111 (25 residues), see Phobius details amino acids 122 to 147 (26 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 236 to 262 (27 residues), see Phobius details amino acids 277 to 295 (19 residues), see Phobius details amino acids 302 to 327 (26 residues), see Phobius details PF03706: LPG_synthase_TM" amino acids 18 to 330 (313 residues), 111.6 bits, see alignment E=2.8e-36 TIGR00374: TIGR00374 family protein" amino acids 43 to 335 (293 residues), 56.7 bits, see alignment E=1.3e-19

Best Hits

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWN2 at UniProt or InterPro

Protein Sequence (353 amino acids)

>CA264_18860 TIGR00374 family protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MDQNKKTILKSFSPVKVLIPVLLGLGATAWLFIKDDRVSELKGIAQANVWWLVAALVVLV
VRDAGYMYRIRSLTDKFLTWRNSVDVIMLWEFASAITPSVVGGTTIATIILNKEGIPLGK
SLAYVMLTAVLDNMFFIVAAPIALLLTQGQVFPTFNLEPADVAKLQSAFYISYGLITLYT
FVMIYALFIKPRAFKWVLLKVTGVGFLRKWRVNAFQHGNEIVWASGQLKGKGFNYWARAI
ISTVFVWSARYFLLNCLIAAFVDVSLSEHMLILSRNLIFWIVMLIAITPGGAGIVEMAFP
SFFGLFLGSFSGIVVVLYRLITYYPYLVLGSIFLPKWIAKVFGRQAQESEVNV