Protein Info for CA264_18835 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 52 to 74 (23 residues), see Phobius details amino acids 81 to 101 (21 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 140 to 158 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 220 to 244 (25 residues), see Phobius details amino acids 253 to 273 (21 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 339 to 363 (25 residues), see Phobius details amino acids 370 to 391 (22 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 355 (336 residues), 85.6 bits, see alignment E=1.6e-28

Best Hits

KEGG orthology group: None (inferred from 51% identity to gfo:GFO_2207)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWI9 at UniProt or InterPro

Protein Sequence (393 amino acids)

>CA264_18835 MFS transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MTQTAALAPPPARILPTIVFSQFAGTSLWFAGNAVLPELQASLGLQEEALGLLTSSVQLG
FILGTLCFAFFALADRMSPRLLFLLCSLLGATANALVLFSATSITGVLLLRGLTGFLLAG
IYPVGMKIAASWYSGGLGKAIGYLVGALVLGTAFPHLLRGLGAALPWQTMLLAVSTLAAA
GGLLMYLLVPDGPYLTKGATFEVRNMLRVFQVRELRAAAFGYFGHMWELYTLWAFVPFIL
LSAFPQWPQSQLSAFSFLVIAAGAVGCIGGGYISQRWGSARVAFAQLLLSGVCCILSVWV
LQTPLLLLPFLLFWGVVVAGDSPQFSALTARTAPPQLMGTALTVVTSAGFAISVLSIQLT
GYLLTTMPAQWVFVLLAVGPLTGLLCMRPLLRR