Protein Info for CA264_18740 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 63 to 92 (30 residues), see Phobius details amino acids 109 to 131 (23 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 189 to 209 (21 residues), see Phobius details amino acids 260 to 282 (23 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 5 to 286 (282 residues), 273.5 bits, see alignment E=9.3e-86 PF00528: BPD_transp_1" amino acids 83 to 284 (202 residues), 64.5 bits, see alignment E=5.4e-22

Best Hits

KEGG orthology group: K02037, phosphate transport system permease protein (inferred from 69% identity to fbc:FB2170_04865)

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWU0 at UniProt or InterPro

Protein Sequence (291 amino acids)

>CA264_18740 phosphate ABC transporter permease subunit PstC (Pontibacter actiniarum KMM 6156, DSM 19842)
MRVSEKIIEGLLWLAAVITILITAGIIWVLLSESISFFRVVPLSDFLTEKEWTPLFADKK
FGIMPLVAGTLLTTAVAIAVALPIGLTIAVYLNEYAHATLKQVVKPMLEVLATIPTVVYG
FFALTVVTPFLQQIIPSLAGFNALSAGIVMGIMIIPMISSLSEDAISSVPRSLREAAYGM
GSTRLQTSFGVMVPAASSGIVVSVILAISRAVGETMIVAIAAGQQPRLTLNPLVPIETIT
TYIVQVSLGDVPQGSLEYKTIFAAGITLFVFTFALNNLSFWIKKKYQEKYD