Protein Info for CA264_18735 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphate ABC transporter, permease protein PstA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 transmembrane" amino acids 14 to 38 (25 residues), see Phobius details amino acids 62 to 90 (29 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 182 to 202 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 250 to 275 (26 residues), see Phobius details TIGR00974: phosphate ABC transporter, permease protein PstA" amino acids 12 to 280 (269 residues), 293 bits, see alignment E=9.5e-92 PF00528: BPD_transp_1" amino acids 84 to 278 (195 residues), 73.9 bits, see alignment E=7.1e-25

Best Hits

KEGG orthology group: K02038, phosphate transport system permease protein (inferred from 74% identity to fbc:FB2170_04870)

Predicted SEED Role

"Phosphate transport system permease protein PstA (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWT1 at UniProt or InterPro

Protein Sequence (285 amino acids)

>CA264_18735 phosphate ABC transporter, permease protein PstA (Pontibacter actiniarum KMM 6156, DSM 19842)
MTNSDINRLKDKAFQVFGIFCTFIGLVVLAIFLIDIIAEGVARIDWDFLVSLPSRRASRA
GILTAWVGTLWILVLTTLIAFPLGVAAGVYLEEYSKKNRLNNFLEINISNLAGVPSIIYG
LLGLEIFVRQMRLGGSLLAGALTLSLLILPIIIVTTREAIKAVPRSIRDGSYALGASKWQ
TVWNQVLPASFGGILTGIILALSRAVGEAAPLIVIGALAYVPFTPASPFDEFTVLPIQIF
NWTSRPQEAFLTNAAAAIIVLLIITFMLNGIAVYLRNRQQKKIKW