Protein Info for CA264_18720 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 213 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 62 (24 residues), see Phobius details amino acids 83 to 113 (31 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details PF03379: CcmB" amino acids 1 to 201 (201 residues), 57.2 bits, see alignment E=8.5e-20

Best Hits

KEGG orthology group: K02194, heme exporter protein B (inferred from 64% identity to sli:Slin_1448)

Predicted SEED Role

"ABC transporter involved in cytochrome c biogenesis, CcmB subunit" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYH1 at UniProt or InterPro

Protein Sequence (213 amino acids)

>CA264_18720 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MQKDLVLEWRQKYALNGMLLYVGSVVFVCYLSFGMRSNILVAPVWNAVLWIILLFTSVNA
IAKGFMQENRGRLLYFYSIVSPQGIILAKIIYNTLLMLLLATICFVFYGFVLGNPVHDVP
MFLLSILLGAIGFSTSLTMISSIAAKAANSSTLMAVLSFPVIVPMLLMLIKMSKNAMDGL
DRSLSLDELLTLLAINMIVVTVSYILFPYLWRS