Protein Info for CA264_18715 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details transmembrane" amino acids 40 to 61 (22 residues), see Phobius details amino acids 75 to 97 (23 residues), see Phobius details amino acids 113 to 131 (19 residues), see Phobius details amino acids 142 to 160 (19 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 8 to 153 (146 residues), 75.9 bits, see alignment E=1.8e-25

Best Hits

KEGG orthology group: K02195, heme exporter protein C (inferred from 63% identity to mtt:Ftrac_2486)

Predicted SEED Role

"Cytochrome c-type biogenesis protein CcmC, putative heme lyase for CcmE" in subsystem Biogenesis of c-type cytochromes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWN5 at UniProt or InterPro

Protein Sequence (221 amino acids)

>CA264_18715 ABC transporter permease (Pontibacter actiniarum KMM 6156, DSM 19842)
MKKNWWKILAIALLVFTVVAGILSEVPRLAILNETIRNLFFHVPMWFGMILILLVSVIYS
IKYLRNPTVKNDVVAYESAKVGILFGVLGIVTGMEWARFTWGDYWSNDPKQNAAAIGLLI
YFAYLVLRSSFNEQQQRARISAVYNIFAFAALIPLLFILPRLTDSLHPGNGGNPGFNTYD
LDSSLRLVFYPAVLGWTLLGIWIVNVKSRLELLRQRLYETV