Protein Info for CA264_18665 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 63 (21 residues), see Phobius details amino acids 86 to 103 (18 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 205 to 225 (21 residues), see Phobius details amino acids 231 to 251 (21 residues), see Phobius details amino acids 259 to 279 (21 residues), see Phobius details PF01040: UbiA" amino acids 35 to 262 (228 residues), 115.3 bits, see alignment E=1.5e-37

Best Hits

Predicted SEED Role

"Similar to (S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWW0 at UniProt or InterPro

Protein Sequence (280 amino acids)

>CA264_18665 prenyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKYILTLIRARNLVMIVLSQALVQACLLAPGVDWAKLLDPGFQVLVLSTVCIAAAGYIIN
DYYDVKIDAINKPDRLLVGRRIRRRRAMFAHLILSAVGVLLGLLLSIPVALINLGAVLLL
WGYSARLKKMLLVGNVVIALLSASMLLVVAVYNDTLNRITLGFALFALLISLIREIIKDV
EDMKGDASFDCRTLPIVAGLRGTKLVLYPLVGLFQVFVLVVVFHPASKPLFDAYMLVLVL
LPSVWLVAKLVRADRKRDFSYLSNLNKFIMLTGILSMLLL