Protein Info for CA264_18635 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphoribosylglycinamide formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00551: Formyl_trans_N
  • amino acids 7 to 187 (181 residues), 158.9 bits, E=5.8e-51
• TIGR00639: phosphoribosylglycinamide formyltransferase
  • amino acids 7 to 191 (185 residues), 159.4 bits, E=3.8e-51

Best Hits

KEGG orthology group: K11175, phosphoribosylglycinamide formyltransferase 1 [EC: 2.1.2.2] (inferred from 57% identity to shg:Sph21_2384)

Predicted SEED Role

"Phosphoribosylglycinamide formyltransferase (EC 2.1.2.2)" in subsystem De Novo Purine Biosynthesis (EC 2.1.2.2)

MetaCyc Pathways

• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (5/6 steps found)
• tetrahydrofolate salvage from 5,10-methenyltetrahydrofolate (2/2 steps found)

KEGG Metabolic Maps

• One carbon pool by folate
• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.2.2

Sequence Analysis Tools

See A0A1X9YY98 at UniProt or InterPro

Protein Sequence (195 amino acids)

>CA264_18635 phosphoribosylglycinamide formyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEPKDKKNIVIFASGSGSNAQRLLEHFEHHPEIRVAALFSNNPKAYALKRAETFHVPALL
FSRDEFYNTGKVLEQVQSFAPDLIVLAGFLWLVPLNLLRAFPNRIINIHPALLPKYGGKG
MHGMHVHTAVLQAQEPESGITIHYINEEYDKGEFILQERCPVQATDTPEELAARVLQLEH
RHLPEVVEKLLLEKA