Protein Info for CA264_18545 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 877 PF01624: MutS_I" amino acids 10 to 118 (109 residues), 130.7 bits, see alignment E=7.2e-42 TIGR01070: DNA mismatch repair protein MutS" amino acids 10 to 865 (856 residues), 944 bits, see alignment E=4.4e-288 PF05188: MutS_II" amino acids 130 to 255 (126 residues), 77.9 bits, see alignment E=2.6e-25 PF05192: MutS_III" amino acids 273 to 561 (289 residues), 147 bits, see alignment E=2.3e-46 PF05190: MutS_IV" amino acids 430 to 521 (92 residues), 99.9 bits, see alignment E=2.1e-32 PF00488: MutS_V" amino acids 615 to 804 (190 residues), 280.1 bits, see alignment E=2.5e-87

Best Hits

Swiss-Prot: 70% identical to MUTS_CYTH3: DNA mismatch repair protein MutS (mutS) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K03555, DNA mismatch repair protein MutS (inferred from 70% identity to chu:CHU_0147)

Predicted SEED Role

"DNA mismatch repair protein MutS" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWQ3 at UniProt or InterPro

Protein Sequence (877 amino acids)

>CA264_18545 DNA mismatch repair protein MutS (Pontibacter actiniarum KMM 6156, DSM 19842)
MKGEGKGTVTPLMKQYNAIKAKHPGALLLFRVGDFYETFGEDAIKASKILDIVLTKRGNG
SASETALAGFPHHSLDTYLPKLVRAGERVAICDQLEDPKTVKGIVKRGVTELVTPGVSFN
DQVLERRSNNYLAAVHFGKTETGVSFLDVSTGEFITAQGDKSYIGKLLQSLAPAEVLFCK
REKETFFERYGPDFRYYALEEWVFNYDFAYESLTRQFSTASLKGFGIEGMREGIVSAGAI
LHYLSETQHNEISHIATISRLEEDKYVWLDRFTVRNLELVYPQHPEGVPLINVLDQTVTP
MGARLLKKWVVLPLKDVTQIRRRLDTVEALTQHQELLEELVLHLKQINDLERLISKVAVR
RVNPRELVQLAKALEAILPIQKVLALSDIPALQKLAAQLAPCDGLREEIRNVLKPEPPML
TNQGNMINEGVNEELDELRAIAFSGKDYLAQLQQREIKNTGISSLKIAYNKVFGYYLEVT
HAHKDKVPSTWIRKQTLVNAERYITEELKTYEEKILNAEERIYTIEFGLFNELVLYAMDY
VAQVQQNAKVIGVIDCLSAFAGIALSSSYVKPEVNDTHVLDIRKGRHPVIEKQLPLGEAY
VPNDIFLDDEQQQVIIITGPNMAGKSALLRQTALVVLMAQIGSFVPAEAATIGVIDKIFT
RVGASDNLSKGESTFMVEMTETASILNNLSDRSLVLMDEIGRGTSTYDGISIAWAIVEHL
HNHPKYKAKTLFATHYHELNQLAEELPRVKNYNVSVREAGGKILFMRKLVPGGSEHSFGI
HVAQMAGMPNNVVLRADEIMHHLEKEKVSEQAPQQKMKTAPKNNFQLSMFELHDPQLERV
KELMEQLDINTITPVEALLKLNELKLLLQDKQKAGAK