Protein Info for CA264_18535 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: TonB dependent receptor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 825 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF13620: CarboxypepD_reg" amino acids 30 to 107 (78 residues), 52.4 bits, see alignment E=1.4e-17 PF13715: CarbopepD_reg_2" amino acids 31 to 124 (94 residues), 42 bits, see alignment E=1.9e-14 PF07715: Plug" amino acids 146 to 226 (81 residues), 42.8 bits, see alignment E=1.7e-14 PF00593: TonB_dep_Rec" amino acids 361 to 713 (353 residues), 65.9 bits, see alignment E=1.6e-21 PF14905: OMP_b-brl_3" amino acids 391 to 797 (407 residues), 389.4 bits, see alignment E=5.6e-120

Best Hits

Predicted SEED Role

"TonB-dependent receptor, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWE0 at UniProt or InterPro

Protein Sequence (825 amino acids)

>CA264_18535 TonB dependent receptor (Pontibacter actiniarum KMM 6156, DSM 19842)
MKTNFYQFILILLFLSTPLLLHAQGQTNGSISGTVVEGPQKTPLGFANVVLLTPRDSSLV
TGATTDISGRFVLERVPPGSYLLRISLVGYPNKYVSNLSVTAAEPSVALGSIALEASTTR
LNEVEIVTERELVEYDLDKRVVNMSQDIAAESGTVADVLQNVPSVAVDIDGNVSLRGSSN
VTILVDGKRSSLANLSLDQIPANLIERVELVTNPSSKYDPEGTSGVINLILKKEKKAGFN
GSASLNVGTYENYNSSLNLNYRYDKWSLNAGYDFRHRTRPGTSSSFTDYLGNTATFRSGA
DSISYNFLDQVRERDNLDVSHNFRFGADYSLSPQKALSASVFYRTDNEEGSSDLLYRFLG
AGRQVIGERTRLTEDTEDGFNMDLNLGYRQTFERKGQELTADLVYANNYDEEGSDFREEY
LGRRSRQSTTTDDQNTRVTAQLDYVHPISDDSQVEAGFRSSFQRLDEDSRFFSYDFEADR
PVFNDTLSNHFVYDEQVHAVYANYSNKYKSFSYQLGLRAEQTFTTSDQRTTNQEYRNDYF
SLFPSIFLTHDINDDNKVQFSYSRRINRPRSRYLNPFVDRTDKFDVDFGNPRLNPEFINS
LELGYLKYWGSSSVNLSTFYRHTTDQIQRLRQTAEVTEDDETYTRLETTFLNLSTSSSYG
VELSATHAVGKWWRLNGSVSGFRTALNDTQGDTELSNQQFSWNSRLNSTMTVWKDLDIQL
NAYYRAPMATLQGRMEQLFSLNLGVQKDVLDKKATVMLRVSDIFNTRQWNYVSYSDEFRT
ESNNRRQSRIVYLGFTYRLNSDDSDKRNRRRDQDSQGGGGDEDEF