Protein Info for CA264_18450 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: aspartate ammonia-lyase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 TIGR00839: aspartate ammonia-lyase" amino acids 5 to 465 (461 residues), 733.1 bits, see alignment E=7.2e-225 PF00206: Lyase_1" amino acids 12 to 343 (332 residues), 315.1 bits, see alignment E=6e-98 PF10415: FumaraseC_C" amino acids 409 to 463 (55 residues), 61.3 bits, see alignment 9.4e-21

Best Hits

Swiss-Prot: 60% identical to ASPA_HELPJ: Aspartate ammonia-lyase (aspA) from Helicobacter pylori (strain J99 / ATCC 700824)

KEGG orthology group: K01744, aspartate ammonia-lyase [EC: 4.3.1.1] (inferred from 72% identity to fjo:Fjoh_3403)

MetaCyc: 57% identical to aspartate ammonia-lyase (Escherichia coli K-12 substr. MG1655)
Aspartate ammonia-lyase. [EC: 4.3.1.1]

Predicted SEED Role

"Aspartate ammonia-lyase (EC 4.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 4.3.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWG2 at UniProt or InterPro

Protein Sequence (469 amino acids)

>CA264_18450 aspartate ammonia-lyase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSEFRMEHDFLGEMEIPNELYYGIQTARALDNFYITGIPISKEPLFIQAFGYVKKAAAMA
NRDCGVLKAEVADAICQACDKLIAGEYLDQFVTDMIQGGAGTSVNMNVNEVVANLALEIL
GHQKGEYQYVHPNNHVNFSQSTNDAYPTAFRLALYRKIESFIESLEALQQAFARKGEEFQ
TVLKMGRTQLQDAVPMTLGAEFHGFSTTIKEDIQRLNEAKMLICEINMGATAIGTSINAP
EGYPAIVTKHLRDLTGIPVVLAEDLIEATCDTGAYVQVSGVMKRSAVKISKICNDLRLLS
SGPRTGINEINLPRMQPGSSIMPGKVNPVIPEVVNQTAFYVIGTDMTVTMAAEAGQLQLN
VMEPVIAYSLFSSLSFMENACYTLTNKCVVGITANEEICANMVMNSVGIITALNPILGYE
ESASIAKEALATGKSIHDITVLERGRITQAKWDEVFSVENLIHPRFINS