Protein Info for CA264_18295 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: iron-sulfur cluster-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 TIGR00273: iron-sulfur cluster-binding protein" amino acids 39 to 413 (375 residues), 464.8 bits, see alignment E=1.4e-143 PF02589: LUD_dom" amino acids 68 to 291 (224 residues), 138.3 bits, see alignment E=9.3e-44 PF13183: Fer4_8" amino acids 306 to 374 (69 residues), 52.7 bits, see alignment E=1.8e-17 PF13534: Fer4_17" amino acids 309 to 374 (66 residues), 29.7 bits, see alignment E=2.6e-10

Best Hits

Swiss-Prot: 48% identical to LUTB_ANOFW: Lactate utilization protein B (lutB) from Anoxybacillus flavithermus (strain DSM 21510 / WK1)

KEGG orthology group: None (inferred from 69% identity to chu:CHU_1019)

Predicted SEED Role

"Predicted L-lactate dehydrogenase, Iron-sulfur cluster-binding subunit YkgF" in subsystem L-rhamnose utilization or Lactate utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYX4 at UniProt or InterPro

Protein Sequence (457 amino acids)

>CA264_18295 iron-sulfur cluster-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKLRQFLQDAETKAFDQGHRATIKFNIGKYNAAVQRGLTQYSDHELARERGSFIKTNTI
NNLDKYLMEFEANFTARGGKVIWARDAQEALKEIGEIMKRKRARSVVKSKSMITEEIHLN
EYLEKNGIETVETDLGEYIVQLAEQRPYHIVTPAMHMSKKDIADLFVRKLGIPPTENAEE
LVGVARKLLREKYTSAEVGITGGNFLIADVGGVAVTENEGNARLSTTFPKTHIAIVGIEK
MIPSIMDLDLFWPLLSTSGTGQNVTVYNSIFTGPRQPKEADGPEEMYVVLLDNGRTDLLA
LPEKREALNCIRCGACLNVCPVYKNIGGHTYETTYSGPIGSVISPHYNGMAEHKHLSFAS
SLCGACTSVCPVKINIHNLLLLNRKQSVDQGMADSQETTAFKFWLKAMKSRKLMNIAPAS
VKNFVLRYVQKDTWSKRREPLQAPKKSFNQLWKEQRG