Protein Info for CA264_18245 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: NADH-quinone oxidoreductase subunit A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00507: Oxidored_q4
  • amino acids 24 to 131 (108 residues), 122.6 bits, E=3.3e-40

Best Hits

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 64% identity to sli:Slin_3628)

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration III (alternative oxidase pathway) (2/3 steps found)
• NADH to cytochrome bd oxidase electron transfer I (1/2 steps found)
• NADH to cytochrome bo oxidase electron transfer I (1/2 steps found)
• Fe(II) oxidation (2/6 steps found)
• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

See A0A1X9YWT8 at UniProt or InterPro

Protein Sequence (169 amino acids)

>CA264_18245 NADH-quinone oxidoreductase subunit A (Pontibacter actiniarum KMM 6156, DSM 19842)
MAENYTSDFGTILLFLVGGAIFVVIGLLTSRLLRPSNPNAEKLATYESGEEPIGNAWVQF
NPRFYVVALIFIIFDVELAFLFPWATVFGRRELIEATDGLWGWFSLVEMFIFIGVLVLGL
AYAWAKGHLDWIKPKPVLPQSRSKIPMDVYQQVNARHEAKGKAGGNSEV