Protein Info for CA264_18220 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: acylphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF00708: Acylphosphatase" amino acids 9 to 91 (83 residues), 84.5 bits, see alignment E=2.6e-28

Best Hits

Swiss-Prot: 50% identical to ACYP_RUBXD: Acylphosphatase (acyP) from Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129)

KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 50% identity to rxy:Rxyl_0794)

Predicted SEED Role

"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWG3 at UniProt or InterPro

Protein Sequence (94 amino acids)

>CA264_18220 acylphosphatase (Pontibacter actiniarum KMM 6156, DSM 19842)
MGKEKKRVAMRVHGKVHGVFFRVSTVEKAEELGLTGFVQNERDGTVYMEAEGAPEALQKL
EQWAHEGPKRARVEKVEVEEKEELNGFGKFEQRR