Protein Info for CA264_18210 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: L-serine dehydratase, iron-sulfur-dependent subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 TIGR00718: L-serine dehydratase, iron-sulfur-dependent, alpha subunit" amino acids 15 to 288 (274 residues), 253.4 bits, see alignment E=1.3e-79 PF03313: SDH_alpha" amino acids 21 to 275 (255 residues), 242.4 bits, see alignment E=3.3e-76

Best Hits

Swiss-Prot: 42% identical to SDHA_PEPAS: L-serine dehydratase, alpha chain (sdhA) from Peptoniphilus asaccharolyticus

KEGG orthology group: K01752, L-serine dehydratase [EC: 4.3.1.17] (inferred from 74% identity to mtt:Ftrac_1933)

MetaCyc: 42% identical to L-serine dehydratase alpha subunit (Peptoniphilus asaccharolyticus)
L-serine ammonia-lyase. [EC: 4.3.1.17]

Predicted SEED Role

"L-serine dehydratase, alpha subunit (EC 4.3.1.17)" in subsystem Glycine and Serine Utilization or Pyruvate Alanine Serine Interconversions (EC 4.3.1.17)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.17

Use Curated BLAST to search for 4.3.1.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWA7 at UniProt or InterPro

Protein Sequence (303 amino acids)

>CA264_18210 L-serine dehydratase, iron-sulfur-dependent subunit alpha (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLLFTDFKSWEKHCAETGEPLYQPVLEYEVEQKGRSEAFIWENIANAFEVMKDAVQTGL
TEDMKSRSGMVNNSAKKVAKSPVTVLSPEFQLLVARALGAKEVNSCMGRVVAAPTAGASG
ILPGTLTTLQELHGLEDRLIHEGLLVAAGIALIIEQNASLAGAVGGCQAETGSAAAMAAG
AIVYCLGGDVKQVFNAVAITIQCMLGLVCDPVAGLVEVPCIVRNASAAAIAFSSAQLGIA
GVDPVIPVDQCVAALGEVGESMERKYKETAEGGLANTPRAREIENFVLVQDVEILPDEDE
ADS