Protein Info for CA264_18180 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: peptidase S41

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 553 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details TIGR00225: C-terminal processing peptidase" amino acids 68 to 370 (303 residues), 308.1 bits, see alignment E=3.4e-96 PF13180: PDZ_2" amino acids 116 to 192 (77 residues), 38.6 bits, see alignment E=2.2e-13 PF00595: PDZ" amino acids 124 to 184 (61 residues), 39.6 bits, see alignment E=1.1e-13 PF17820: PDZ_6" amino acids 134 to 185 (52 residues), 38.7 bits, see alignment 1.4e-13 PF03572: Peptidase_S41" amino acids 215 to 371 (157 residues), 180.9 bits, see alignment E=3e-57

Best Hits

KEGG orthology group: K03797, carboxyl-terminal processing protease [EC: 3.4.21.102] (inferred from 62% identity to chu:CHU_0689)

Predicted SEED Role

"Carboxy-terminal processing protease"

Isozymes

Compare fitness of predicted isozymes for: 3.4.21.102

Use Curated BLAST to search for 3.4.21.102

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWI6 at UniProt or InterPro

Protein Sequence (553 amino acids)

>CA264_18180 peptidase S41 (Pontibacter actiniarum KMM 6156, DSM 19842)
MDKMEQGDGRQEIRNSPFQIKLPLFIGMALVVGVLLGATTFAPSSNNPQGTAKSYLKFRD
ILSYIDRDYVDTVDIEKLTDFAITEMLHKLDPHTAYIPADELAMARSYLEGDFEGIGVEF
NIFKDTIYVITPLSGGPSEAAGIQAGDKIIKVNGENVAGTGINNEGVFKRLRGKQGTKVS
LTIQREAVKKPLTFTIERSKIPTYSVDVSYMVDKKTGYIKVSRFSATTYEEFQEALLDLK
SKGLEQLILDLRGNPGGYMDHAIRMADEFVSGNKMIVYTDGKGDKYDSKTFAEEQGAFED
GPLIVLLDEGSASASEIVAGALQDNDRALIVGRRSFGKGLVQMPIPLNDGSELRLTISRY
YTPSGRSIQKPYGEGMEDYQMDILNRFENGEYFHPDSSLFVDSLKYKTLKGRPVYGGGGI
MPDVFVPRDTTELSEYLSQLYNKNIIREYTLEYYQKHRKELEKMPFEKFNKSFEVTDKML
QDVVQMARASGVAYNDAEFRRSKNLLRNNLKAFISRSVYGNSGFFPVLHQSDEEFQQALK
HFSRAQGLAAGSM