Protein Info for CA264_18135 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 PF00005: ABC_tran" amino acids 19 to 166 (148 residues), 83.5 bits, see alignment E=2.3e-27

Best Hits

Swiss-Prot: 34% identical to MNTB_BACHD: Manganese transport system ATP-binding protein MntB (mntB) from Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125)

KEGG orthology group: K09820, manganese/iron transport system ATP-binding protein (inferred from 34% identity to bha:BH1389)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWI2 at UniProt or InterPro

Protein Sequence (241 amino acids)

>CA264_18135 ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MIVDAQNLVAGYGQRVLIRNLSFSIPSPAFVAIIGHNGAGKTTLFRAFQGKIDYEGQLLV
QGHNLRHLSNPSAKGLLAYLPQKNTINFPIKVHDLVVMGLFRKKRFFEHYGPDDYALAAR
TLEQLQLSHLIDHDFTTLSGGEQQLVWLAQLMLQDAGINLLDEPTQQLDVYYKSKVFSLL
QEWVVQSGKTILCITHDLQNLQSLRGYLLNLSKPTPVLEAISPEAVQENQAFLEAGRQPA
L