Protein Info for CA264_18130 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00453: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase
  • amino acids 8 to 221 (214 residues), 215.5 bits, E=3.1e-68
• PF01128: IspD
  • amino acids 8 to 221 (214 residues), 180.5 bits, E=6.4e-57
• PF12804: NTP_transf_3
  • amino acids 8 to 161 (154 residues), 61 bits, E=2.4e-20

Best Hits

Swiss-Prot: 53% identical to ISPD_BACTN: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (ispD) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K00991, 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [EC: 2.7.7.60] (inferred from 52% identity to chu:CHU_3100)

Predicted SEED Role

"2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60)" in subsystem Isoprenoid Biosynthesis or Teichoic and lipoteichoic acids biosynthesis or polyprenyl synthesis (EC 2.7.7.60)

MetaCyc Pathways

• methylerythritol phosphate pathway II (8/9 steps found)
• superpathway of geranylgeranyl diphosphate biosynthesis II (via MEP) (8/12 steps found)
• taxadiene biosynthesis (engineered) (8/13 steps found)
• methylerythritol phosphate pathway I (5/9 steps found)
• isoprene biosynthesis I (5/10 steps found)
• superpathway of ergosterol biosynthesis II (7/26 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Terpenoid biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.60

Sequence Analysis Tools

See A0A1X9YWH6 at UniProt or InterPro

Protein Sequence (228 amino acids)

>CA264_18130 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MAQLPQYAIIVAGGSGSRMQRDTPKQFLEVAGKPVLMHTIERFYKYNPAIRLIVVLPQEQ
LNTWRELCRKHTFKLFHMTVPGGATRFGSVKNGLDAVMGEGLVAVHDGVRPFVETETIKA
AFEAAEQQGSAVVAVSPKDSIRELTESGSRAVPRAKYKLVQTPQCFRASILRKAYEQPEQ
EHFTDDASVVESTGEKITLVEGSYRNIKITTPEDLILAEAFASQDLQG