Protein Info for CA264_18115 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Rossman fold protein, TIGR00730 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 TIGR00730: TIGR00730 family protein" amino acids 99 to 274 (176 residues), 143.6 bits, see alignment E=2.7e-46 PF18306: LDcluster4" amino acids 99 to 225 (127 residues), 59.3 bits, see alignment E=3.5e-20 PF03641: Lysine_decarbox" amino acids 141 to 272 (132 residues), 111.7 bits, see alignment E=3e-36

Best Hits

KEGG orthology group: K06966, (no description) (inferred from 77% identity to mtt:Ftrac_2499)

Predicted SEED Role

"FIG01093783: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWE5 at UniProt or InterPro

Protein Sequence (287 amino acids)

>CA264_18115 Rossman fold protein, TIGR00730 family (Pontibacter actiniarum KMM 6156, DSM 19842)
MTKLRKTSKTKLHEESINTGSGQTILKPDVNENKARSVTDLRESGQSTAAPASEEDRKIR
QAFVDKDWNEIKIADSWQIFKVMAEFVDGFEKLAKIGPCVSVFGSARTKSDNKYYIMAEE
IAAKLVRHGYGVITGGGPGIMEAGNKGAHSEGGRSVGLNIQLPFEQFNNIYIDSDKLINF
DYFFVRKVMFVKYAQGFIGMPGGFGTLDELFEAITLIQTKKIGAFPIVLVGRSYWEGLFK
WIEDVMLHTENNISAEDLDLVHIVDDATEAVKIIDDFYSKYLLSPNF