Protein Info for CA264_18075 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 3-dehydro-L-gulonate 2-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF02615: Ldh_2" amino acids 9 to 330 (322 residues), 366.7 bits, see alignment E=5.8e-114

Best Hits

Swiss-Prot: 48% identical to DLGD_ECO27: 2,3-diketo-L-gulonate reductase (dlgD) from Escherichia coli O127:H6 (strain E2348/69 / EPEC)

KEGG orthology group: K08092, 3-dehydro-L-gulonate 2-dehydrogenase [EC: 1.1.1.130] (inferred from 60% identity to phe:Phep_3438)

MetaCyc: 48% identical to 2,3-diketo-L-gulonate reductase (Escherichia coli K-12 substr. MG1655)
3-dehydro-L-gulonate 2-dehydrogenase. [EC: 1.1.1.130]

Predicted SEED Role

"3-dehydro-L-gulonate 2-dehydrogenase (EC 1.1.1.130)" in subsystem L-ascorbate utilization (and related gene clusters) (EC 1.1.1.130)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.130

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWG7 at UniProt or InterPro

Protein Sequence (334 amino acids)

>CA264_18075 3-dehydro-L-gulonate 2-dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MEQEKQARVSFEELRAQFKKVLLKNGFSEEKAALCAQVFAENSRDGVYSHGLNRFPVFVQ
MVKDGIISTDAEPEQINQHGVVEQWDGNMAPGVYVAIKATARAIELAKKNGMGCVAVRNT
NHWMRGGTYGWQAADAGCICICATNSIANMPPFGGKDPRLGNNPLVIAVPRKEGHLVLDM
AISQFSYGKMQEYELKGEQLPVDGGFDKEGNSTKDPGKIRESERPLPIGFWKGSGLSFML
DVLVASLSGGRNVAEVTKSGNEAGVSQFFLCLDAENVEEAILNSIVDYTKSSRPAEGKGD
IRYPGEGTLNTRRENEKEGIPVSQEMWQKVQDLL