Protein Info for CA264_18065 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: asparagine--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 479 TIGR00457: asparagine--tRNA ligase" amino acids 5 to 479 (475 residues), 637.4 bits, see alignment E=6.5e-196 PF01336: tRNA_anti-codon" amino acids 19 to 97 (79 residues), 46.1 bits, see alignment E=3.9e-16 PF00152: tRNA-synt_2" amino acids 118 to 473 (356 residues), 234.7 bits, see alignment E=1.5e-73

Best Hits

KEGG orthology group: K01893, asparaginyl-tRNA synthetase [EC: 6.1.1.22] (inferred from 72% identity to cpi:Cpin_1004)

Predicted SEED Role

"Asparaginyl-tRNA synthetase (EC 6.1.1.22)" in subsystem tRNA aminoacylation, Asp and Asn (EC 6.1.1.22)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.22

Use Curated BLAST to search for 6.1.1.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW68 at UniProt or InterPro

Protein Sequence (479 amino acids)

>CA264_18065 asparagine--tRNA ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MQRTKVKDLLQGAEVGKEVLLKGWVRTKRGNKYVNFIAVNDGSTINNLQVVAEAEKFPEE
ALKDVTTGAAIAVTGELVASQGKGQAYEIQATSIEVLGKADPEAYPLQKKAHSLEFLREI
AHLRFRTNTFGAVFRVRNAMAFAVHKFFNEKGFVYMHTPIITASDAEGAGEMFQVTTLDL
NNPPRTEDGNINFEEDFFGRATNLTVSGQMEGEVAAMAFSDIYTFGPTFRAENSNTTRHL
AEFWMIEPEMAFYDLKMNADLAEEFIKYVIRYALENNREDIEFLAQRQAEEDKSKPQNER
QEMTLIEKLEMVVNNDFERITYTEAIDILLNSNHYKKKKFQYDVSWGIDLQSEHERYLVE
KHFKKPVIVTDYPKDIKAFYMRLNDDGKTVAAMDILAPGIGEIVGGSQREERMDVLVERM
KSVGINPDDMWWFLDTRRFGGCPHAGFGLGFERVVQFVTGMGNIRDVIPFPRTPQNAEF