Protein Info for CA264_18040 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: kynurenine 3-monooxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 51% identical to KMO_FLAJ1: Kynurenine 3-monooxygenase (kmo) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K00486, kynurenine 3-monooxygenase [EC: 1.14.13.9] (inferred from 56% identity to fte:Fluta_1606)

Predicted SEED Role

"Kynurenine 3-monooxygenase (EC 1.14.13.9)" in subsystem NAD and NADP cofactor biosynthesis global (EC 1.14.13.9)

MetaCyc Pathways

NAD de novo biosynthesis II (from tryptophan) (9/9 steps found)
L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (5/5 steps found)
superpathway of NAD biosynthesis in eukaryotes (11/14 steps found)
3-hydroxy-4-methyl-anthranilate biosynthesis II (4/5 steps found)
L-tryptophan degradation III (eukaryotic) (10/15 steps found)
3-hydroxy-4-methyl-anthranilate biosynthesis I (3/6 steps found)
L-tryptophan degradation IX (7/12 steps found)
L-tryptophan degradation XI (mammalian, via kynurenine) (11/23 steps found)

KEGG Metabolic Maps

Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW70 at UniProt or InterPro

Protein Sequence (455 amino acids)

>CA264_18040 kynurenine 3-monooxygenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MTERKNIAIMGAGLVGSLLSLYLAKRGHKVDLYERRPDLRKTSVDGGRSINLALSDRGWR
ALKGIGIEEDVRKVAIPMYGRMMHDEQGNLTYQPYGKEGQAIYSVSRGGLNMALMNLSEP
NPDITYHFGRQAMDVNLHSNEVQLRNIETGSVETVQPDLLFGADGAFSVVRGAMQKTERY
DYQQSYLEYGYKELTIPATADGGWVIEKNALHIWPRGNYMMIALPNFDGSFTCTLFFPYE
GERSFASIKSEEDLLAFFREVFPDAVPLMPDLAQEYFSHPVGSLVTIKCFPWSHKGKSLL
IGDACHAVVPFYGQGMNAGFEDITVLDQMLDTFDGEDWEELFHRFERTRKPNADAIADLA
VMNFIEMRDKVADPRFLLRKKIEARISEQYPGKWLTLYTMVTFSELPYSYALETGKVQDR
IMKQVMKHIKSVDDYNKPEVQQLIERELLKKEKLS