Protein Info for CA264_18030 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: cation transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 30 to 48 (19 residues), see Phobius details amino acids 61 to 80 (20 residues), see Phobius details amino acids 100 to 128 (29 residues), see Phobius details amino acids 168 to 187 (20 residues), see Phobius details amino acids 199 to 222 (24 residues), see Phobius details amino acids 244 to 269 (26 residues), see Phobius details amino acids 290 to 309 (20 residues), see Phobius details amino acids 315 to 336 (22 residues), see Phobius details amino acids 347 to 366 (20 residues), see Phobius details amino acids 378 to 398 (21 residues), see Phobius details PF00999: Na_H_Exchanger" amino acids 9 to 397 (389 residues), 124.9 bits, see alignment E=1.8e-40

Best Hits

KEGG orthology group: None (inferred from 49% identity to hxa:Halxa_2484)

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWP7 at UniProt or InterPro

Protein Sequence (423 amino acids)

>CA264_18030 cation transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSTYILVITLVGLAALSMAWVPALLKRTFISYPIIFLLLGIGIYMLPVELPIPDPIWQEN
YVVHITELSVIISLMGTGLKIRRKVSWRRWRVPLRLVSITMLLCIGGLALLGWSVLGMAV
SAAILLGAVLAPTDPVLAEQVQVGPPNEKEEDEVRFSLTAEAGLNDGMAFPFTWLAVVIA
IAAEATDGEWLSGWLLRDLLYRIVSGVVIGFLIGRGLAYLIFQLPRTSGFPKAQEGFLAL
SATLVVYGVTEMAHGYGFIAVFVAAITLSSCEPEHDYHTEMHDFVNQIEHILMVVLLMLF
GGSLVFGLLDYLTWQGIVVGLVFLFVIRPLAGLLGMWGIKMPMREKLAISFFGIRGIGSF
FYLSFALDKVTFVDADQLWAVVGFIVLVSVVLHGVTATKSMSYLDYRRSRSGKVRVPGVV
KKE