Protein Info for CA264_18025 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium/alanine symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 464 transmembrane" amino acids 20 to 42 (23 residues), see Phobius details amino acids 71 to 91 (21 residues), see Phobius details amino acids 97 to 120 (24 residues), see Phobius details amino acids 149 to 169 (21 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 222 to 239 (18 residues), see Phobius details amino acids 251 to 274 (24 residues), see Phobius details amino acids 307 to 333 (27 residues), see Phobius details amino acids 356 to 377 (22 residues), see Phobius details amino acids 398 to 418 (21 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details TIGR00835: amino acid carrier protein" amino acids 16 to 448 (433 residues), 410.6 bits, see alignment E=3.7e-127 PF01235: Na_Ala_symp" amino acids 58 to 455 (398 residues), 413.7 bits, see alignment E=5.4e-128

Best Hits

KEGG orthology group: K03310, alanine or glycine:cation symporter, AGCS family (inferred from 64% identity to mtt:Ftrac_3788)

Predicted SEED Role

"Sodium:alanine symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWG5 at UniProt or InterPro

Protein Sequence (464 amino acids)

>CA264_18025 sodium/alanine symporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKELERFLVDFSNAAWGMPLLLLLMGGGFFFMVYSGFLPFRYLGHAINVLRGKYDDPDDP
GDINHFEALSSALAATVGMGNISGVAVAIATGGPGVLFWMWVSAFVGMATKFFTCSLAIM
YRGRDTNGHVEGGPMYVITEGLGSKWKPLAAFFAVAGLFGTLPIFQANQLTQVLREVVLV
PNGVATENPFYWNLGIGLTLVAITSLVIFGGIKRIGHVAGKMVPSMVLLYMVAVLYIMFV
NRESIPGAFALIFEDAFSARAVLGGAVGAIIIAGARRAAFSNEAGIGTAAMMHGAAKTDE
PIREGLVAMLGPFIDTLVVCTLTGLAIIVTGTWHTSDDNGVTMTATAFGSALPGGIGSYV
LVLCVLIFAFTSLFSYSYYGTKCFGFLFGARYKHYYNYFYVFTIVFGAVASITAVLALID
GMYAMMAIPTMVSALILSPKVMRAARDYFKRMREFREEREELNV