Protein Info for CA264_18010 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 188 to 212 (25 residues), see Phobius details PF04909: Amidohydro_2" amino acids 3 to 328 (326 residues), 137.9 bits, see alignment E=3e-44

Best Hits

Swiss-Prot: 63% identical to ACMSD_DICDI: 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (acmsd) from Dictyostelium discoideum

KEGG orthology group: K03392, aminocarboxymuconate-semialdehyde decarboxylase [EC: 4.1.1.45] (inferred from 74% identity to mtt:Ftrac_2833)

MetaCyc: 62% identical to aminocarboxymuconate-semialdehyde decarboxylase (Homo sapiens)
Aminocarboxymuconate-semialdehyde decarboxylase. [EC: 4.1.1.45]

Predicted SEED Role

"2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (EC 4.1.1.45)" (EC 4.1.1.45)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYI9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>CA264_18010 2-amino-3-carboxymuconate-6-semialdehyde decarboxylase (Pontibacter actiniarum KMM 6156, DSM 19842)
MKIDIHTHILPANWPNLRDRYGYGGFIRLEHHKPCCARMMMDDKFFREIQDNCWDPRVRM
HECSQHKVGVQVLSTVPVMFNYWAKPEHTYDLSRMLNDHIAGIVADYPDRFVGLGTLPMQ
EPELAVKELERCMKELGMAGIQIGTHINDWNLEEPELFPVFEAAEALGAAIFVHPWDMFG
KEKMSKYWLPWLVGMPAETSMAICSMIFGGVLERLPKLRVAFAHGGGSFPATIGRIAHGF
EVRPDLCAVDNNVNPRNYLGKFYLDSLVHDPAALDYLVNLVGANSIALGTDYPFPLGELE
PGKIIESMPYDLATKERMLSGTALEWLNLKKEQFVKGQGRVKEKA