Protein Info for CA264_17985 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 157 TIGR00738: Rrf2 family protein" amino acids 1 to 130 (130 residues), 84.4 bits, see alignment E=3.1e-28 PF02082: Rrf2" amino acids 4 to 131 (128 residues), 92.3 bits, see alignment E=1.5e-30

Best Hits

Swiss-Prot: 44% identical to NSRR_PHOLL: HTH-type transcriptional repressor NsrR (nsrR) from Photorhabdus luminescens subsp. laumondii (strain DSM 15139 / CIP 105565 / TT01)

KEGG orthology group: K13771, Rrf2 family transcriptional regulator, nitric oxide-sensitive transcriptional repressor (inferred from 47% identity to bpa:BPP1638)

Predicted SEED Role

"Nitrite-sensitive transcriptional repressor NsrR" in subsystem Nitrosative stress or Oxidative stress or Rrf2 family transcriptional regulators

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW67 at UniProt or InterPro

Protein Sequence (157 amino acids)

>CA264_17985 hypothetical protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKLNHFTDIGLRICMYMAQKQQHNAATTISELSERLCISRNHLVKVVQFLSNNKILAATR
GRGGGLRLGDKAGSIRIGQLVQLLEQSSNLINCQSISCVLDGSCLLKLALDSAYQAFIEH
LDHFSLQDVTAGKAGVLLQQLIQPSIAISVDPVDIQA