Protein Info for CA264_17980 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chloride channel protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 30 to 52 (23 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 159 to 182 (24 residues), see Phobius details amino acids 196 to 219 (24 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 309 to 328 (20 residues), see Phobius details amino acids 336 to 355 (20 residues), see Phobius details amino acids 361 to 378 (18 residues), see Phobius details amino acids 384 to 409 (26 residues), see Phobius details PF00654: Voltage_CLC" amino acids 75 to 407 (333 residues), 208.2 bits, see alignment E=1e-65

Best Hits

KEGG orthology group: None (inferred from 64% identity to cao:Celal_3575)

Predicted SEED Role

"Chloride channel protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW61 at UniProt or InterPro

Protein Sequence (423 amino acids)

>CA264_17980 chloride channel protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MDFKRRRLAVTLRNQLNYPLQFNPFVFSKLFLLWIAVGIVGGVIAGFYWTVLEGLLHFLA
QFQGLYVIPIMAVAGLLAGLVIHFLGDPGEMDLIVNNIRFKGGRLEPKNNPSMILSSWLC
IASGGSAGPEAPLVQVVGSTGTWIARKLRIKGEDLRSLSIAGMASAFTALFGAPLGGSLF
ALEIQHHKHISEYYQALMPALVASCSSYVIFLLVTHIGIGPTWVFPIYATPELNDFFYAM
LYALAGTAAGWLFIFTVRQCRRIFQKLHVPIYIKMMIGGLIIGTIAYFVPLSRYFSHDEL
NVLLEEQFTLEFLLILLGAKILAIAFTVTSGWRGGFIIPLFFVGATVGMIVNTAFPGQNL
PLIMVSCMAAINACVTRTPISTTILLATLTGFHHFIPILFASLTGFFLAPKTPLINAQLG
VKE