Protein Info for CA264_17960 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: proline--tRNA ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 TIGR00408: proline--tRNA ligase" amino acids 7 to 492 (486 residues), 528.3 bits, see alignment E=9.8e-163 PF00587: tRNA-synt_2b" amino acids 115 to 283 (169 residues), 67.6 bits, see alignment E=2.2e-22 PF03129: HGTP_anticodon" amino acids 302 to 397 (96 residues), 74.3 bits, see alignment E=1e-24 PF09180: ProRS-C_1" amino acids 425 to 492 (68 residues), 88.9 bits, see alignment E=3e-29

Best Hits

Swiss-Prot: 74% identical to SYP_FLAJ1: Proline--tRNA ligase (proS) from Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101)

KEGG orthology group: K01881, prolyl-tRNA synthetase [EC: 6.1.1.15] (inferred from 80% identity to cly:Celly_2307)

Predicted SEED Role

"Prolyl-tRNA synthetase (EC 6.1.1.15), archaeal/eukaryal type" (EC 6.1.1.15)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.1.1.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWE8 at UniProt or InterPro

Protein Sequence (492 amino acids)

>CA264_17960 proline--tRNA ligase (Pontibacter actiniarum KMM 6156, DSM 19842)
MSKGLPKRSEDYSLWYNELVKKAGLAENSAVRGCMVIKPYGFAIWEKMQRVLDDMFKATG
HENAYFPLFVPKSLFEAEEQNAEGFAKECAVVTHYRLQTDPDKAGKLRVDPNAKLEEELI
VRPTSEAIIWSTYKNWIQSYRDLPLLINQWANVVRWEMRTRLFLRTAEFLWQEGHTAHAT
ADEAIAETKQMMEVYATFAEQFIALPVIRGVKTPSERFAGALDTYCIEGLMQDGKALQAG
TSHFLGQNFAKAFDVKYATKEGGLEHVWGTSWGVSTRLMGALVMAHSDDEGLVLPPKLAP
IQVVIVPIYKGEEQLAQISEKVNQLKRELEAKGISVKYDNRDTERPGFKFAEWELKGVPV
RVAIGARDLENGTAEIARRDTKEKSSQQFAGLADYIPALLDEIQENIYTRALNYREEHTT
KVDTYEEFKEVLENKGGFVLAHWDGTPETEERIKEETKATIRCIALNSPEEEGVDMLTGK
PSKQRVYFAKAY