Protein Info for CA264_17925 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: chromate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 390 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 78 to 103 (26 residues), see Phobius details amino acids 112 to 133 (22 residues), see Phobius details amino acids 142 to 169 (28 residues), see Phobius details amino acids 189 to 210 (22 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details amino acids 257 to 280 (24 residues), see Phobius details amino acids 292 to 316 (25 residues), see Phobius details amino acids 328 to 348 (21 residues), see Phobius details amino acids 357 to 387 (31 residues), see Phobius details PF02417: Chromate_transp" amino acids 12 to 168 (157 residues), 106.6 bits, see alignment E=7.5e-35 amino acids 217 to 387 (171 residues), 132.3 bits, see alignment E=8.8e-43 TIGR00937: chromate efflux transporter" amino acids 13 to 386 (374 residues), 208.1 bits, see alignment E=1.6e-65

Best Hits

KEGG orthology group: K07240, chromate transporter (inferred from 59% identity to sli:Slin_1603)

Predicted SEED Role

"Chromate transport protein ChrA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW79 at UniProt or InterPro

Protein Sequence (390 amino acids)

>CA264_17925 chromate transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLRYYIFLKDVLMLAFTAFGGPQAHIAMMFKLLVDKRRYLTEQELIELNALCSILPGPT
STQTITAIGYKIGGPNLAYLTLLVWIAPAATIMAIAALAISYLQDQGISLEFLKIIQPMA
VGFVAYAAYMISVKVVNTKTGVVLMVISAILAYFFSSPWVFPALLIAGGSVTALRFRQHP
LEQDKKLRIQWANFVLYVAVLITAAVLGKATSSLPVRLFENFYRNGSLVFGGGQVLIPLL
YAEFVDFKGYLTGEEFLSGYAIVQALPGPTFSFASFVGNLAMRKFGTAGQMLGSFVATVG
IFLPGTFLIFFVIRFWDELKKYRVVRASLEGISAVSSGMVVAAAILLYHPIENTVLNFGI
VAATFCLLMFTKIPPPLLILTGLLLGFAIY