Protein Info for CA264_17915 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: LPS biosynthesis protein WbpP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 15 to 34 (20 residues), see Phobius details PF05368: NmrA" amino acids 17 to 135 (119 residues), 28.1 bits, see alignment E=4.7e-10 PF01370: Epimerase" amino acids 17 to 257 (241 residues), 191.1 bits, see alignment E=7.8e-60 PF01073: 3Beta_HSD" amino acids 17 to 246 (230 residues), 82.7 bits, see alignment E=8.6e-27 PF16363: GDP_Man_Dehyd" amino acids 17 to 320 (304 residues), 179.5 bits, see alignment E=4.6e-56 PF02719: Polysacc_synt_2" amino acids 17 to 246 (230 residues), 59.8 bits, see alignment E=8.8e-20 PF07993: NAD_binding_4" amino acids 18 to 169 (152 residues), 31 bits, see alignment E=5.2e-11 PF13460: NAD_binding_10" amino acids 20 to 165 (146 residues), 42.6 bits, see alignment E=2.2e-14

Best Hits

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 62% identity to gfo:GFO_2041)

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWE4 at UniProt or InterPro

Protein Sequence (341 amino acids)

>CA264_17915 LPS biosynthesis protein WbpP (Pontibacter actiniarum KMM 6156, DSM 19842)
MYDFPYHDKPLSNTSFLVTGGAGFIGSNLVEYLLKYKAGKVRVLDNFSNGYRKNIEQFLD
NPAFELMEGDIRDPQTCMEACAGMDVVLHQAALGSVPRSINDPITSNDVNVGGFVNMLTA
AKENNIKRFVYAASSSTYGDSKELPKVEDRIGKPLSPYAVTKYANELYADVFGKTYGMEI
IGLRYFNIFGPRQDPNGAYAAVIPLFIDALIHNRSPKINGDGGQTRDFTFIENCVQANIK
AALVDNAEAVNQVYNIAVGDRTSLLEMFHILKKAAAVDVEPVHGPDRAGDIRDSLADISK
AKGLLQYEPKVRIEEGLQRTFDWFKENQEFIYRDTKAAAAH