Protein Info for CA264_17900 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: UDP-N-acetyl-D-galactosamine dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03721: UDPG_MGDP_dh_N
  • amino acids 11 to 186 (176 residues), 115.2 bits, E=5.8e-37
• TIGR03026: nucleotide sugar dehydrogenase
  • amino acids 11 to 414 (404 residues), 395.9 bits, E=9.3e-123
• PF00984: UDPG_MGDP_dh
  • amino acids 205 to 293 (89 residues), 86.8 bits, E=1.8e-28
• PF03720: UDPG_MGDP_dh_C
  • amino acids 320 to 417 (98 residues), 82.4 bits, E=5.4e-27

Best Hits

Swiss-Prot: 53% identical to VIPA_SALTI: Vi polysaccharide biosynthesis protein VipA/TviB (vipA) from Salmonella typhi

KEGG orthology group: K02474, UDP-N-acetyl-D-galactosamine dehydrogenase [EC: 1.1.1.-] (inferred from 70% identity to fte:Fluta_2063)

MetaCyc: 58% identical to UDP-N-acetylgalactosamine 6-dehydrogenase (Pseudomonas aeruginosa)
UDP-N-acetylglucosamine 6-dehydrogenase. [EC: 1.1.1.136]; 1.1.1.136 [EC: 1.1.1.136]

Predicted SEED Role

"UDP-glucose dehydrogenase (EC 1.1.1.22)" in subsystem Lipid A-Ara4N pathway ( Polymyxin resistance ) or Teichuronic acid biosynthesis (EC 1.1.1.22)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• UDP-α-D-xylose biosynthesis (2/2 steps found)
• UDP-α-D-glucuronate biosynthesis (from UDP-glucose) (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-N-acetyl-α-D-galactosaminuronate biosynthesis (1/2 steps found)
• UDP-sugars interconversion (4/9 steps found)
• UDP-2,3-diacetamido-2,3-dideoxy-α-D-mannuronate biosynthesis (1/5 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Pentose and glucuronate interconversions
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Starch and sucrose metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-, 1.1.1.22

Use Curated BLAST to search for 1.1.1.- or 1.1.1.136 or 1.1.1.22

Sequence Analysis Tools

See A0A1X9YW40 at UniProt or InterPro

Protein Sequence (429 amino acids)

>CA264_17900 UDP-N-acetyl-D-galactosamine dehydrogenase (Pontibacter actiniarum KMM 6156, DSM 19842)
MYEQLLNKEAKLAVIGLGYVGLPIALAFAKKIKVIGFDINSKRVELMRNSIDPSGELESS
EFEGADITFTDSLDVLREAQFFIVAVPTPIDNYAQPDLKPLLSASATVGKVLKKGDYVVF
ESTVYPGCTEEDCVPVLERESGLKFGEDFKVGYSPERINPGDKEHTLAKIVKVVSGSDPE
AAEEIAQVYELVIDAGVHRASTIKVAEAAKVIENTQRDLNIALMNELSIIFDKMNINTYE
VLEAAGTKWNFLRFSPGLVGGHCIGVDPYYLTYKAKALGYDAKVILSGRSTNDNMGAHIA
NKLVKMMIMRGKNISQTKVLVMGATFKENVEDIRNSKVVDVIRELKSFGVNVEVVDPYAN
SEELQHEYGFGLVEAAGKGYDAVVVAVPHQPYLELDENYFKSIMNDAPILVDLKGILRGK
IKDIEYTSL