Protein Info for CA264_17890 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 PF00383: dCMP_cyt_deam_1" amino acids 3 to 103 (101 residues), 70.3 bits, see alignment E=1.7e-23 PF14437: MafB19-deam" amino acids 5 to 144 (140 residues), 45.8 bits, see alignment E=8.3e-16 TIGR00326: riboflavin biosynthesis protein RibD" amino acids 9 to 322 (314 residues), 307 bits, see alignment E=9.1e-96 PF01872: RibD_C" amino acids 151 to 310 (160 residues), 119.6 bits, see alignment E=2.4e-38

Best Hits

KEGG orthology group: K11752, diaminohydroxyphosphoribosylaminopyrimidine deaminase / 5-amino-6-(5-phosphoribosylamino)uracil reductase [EC: 1.1.1.193 3.5.4.26] (inferred from 60% identity to sli:Slin_2937)

Predicted SEED Role

"Diaminohydroxyphosphoribosylaminopyrimidine deaminase (EC 3.5.4.26) / 5-amino-6-(5-phosphoribosylamino)uracil reductase (EC 1.1.1.193)" in subsystem Riboflavin, FMN and FAD metabolism (EC 1.1.1.193, EC 3.5.4.26)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.193 or 3.5.4.26

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWA2 at UniProt or InterPro

Protein Sequence (345 amino acids)

>CA264_17890 bifunctional diaminohydroxyphosphoribosylaminopyrimidine deaminase/5-amino-6-(5-phosphoribosylamino)uracil reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MATTDEKYMRRALELAQLGNGYTSPNPMVGCVVVHNGQIIGEGWHQKYGGPHAEVNAIAA
VEDKSLLPKSRVYVTLEPCSHYGKTPPCADLLISHGVKDVVICNTDPNPLVAGRGIKKLF
ESGAQVKVGVLEEQGLALNRRFFTFHTQKRPYVFLKWAETADGFIAAANYRQEQISGRLA
QRLVHKWRSEEQAIMVGSRTALYDNPRLNTRLWQGQQPLRLVIDKQLLLPPHLHLFDGSW
PTVVYTHQKQQDRENVHFVQLEAGELMLPQIMQDLYQRNVLSVLVEGGTFLLESLLQENL
WDEALVFKSPSKLLLAGVKAPGMSYGQLKSIQTLGPDQLLHYTRS