Protein Info for CA264_17870 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: phosphatidate cytidylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 261 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 173 to 192 (20 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details PF01148: CTP_transf_1" amino acids 2 to 261 (260 residues), 198.6 bits, see alignment E=8.7e-63

Best Hits

KEGG orthology group: K00981, phosphatidate cytidylyltransferase [EC: 2.7.7.41] (inferred from 44% identity to dfe:Dfer_2993)

Predicted SEED Role

"Phosphatidate cytidylyltransferase (EC 2.7.7.41)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.7.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYA9 at UniProt or InterPro

Protein Sequence (261 amino acids)

>CA264_17870 phosphatidate cytidylyltransferase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIVGVLGAAVFIGGIWYSEWTYFLLFLGLTLLGISEFYNLVSVQGMRPNKPLGLLVGGVF
FTSMFLVQNEAMPGELLYLSLPLLFLVFIVEMYRKKPQPFTNIAFTLLGVTYVAGPFGLL
HLLGFLNGAYSWQPILGLMLLIWAADTGAYIAGKSFGKHKLFERISPGKTWEGWAGGTLL
AVLVGYGMSFLFVDLELYQWVGMAVLVAVFGVLGDLSESMLKRSLGVKDSGTLLPGHGGI
LDRFDSLLMAIPFIVTFLEIF