Protein Info for CA264_17865 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: CPBP family intramembrane metalloprotease domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 321 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 65 to 88 (24 residues), see Phobius details amino acids 104 to 127 (24 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 197 to 216 (20 residues), see Phobius details amino acids 221 to 238 (18 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 279 to 298 (20 residues), see Phobius details PF02517: Rce1-like" amino acids 166 to 254 (89 residues), 70 bits, see alignment E=8.3e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW71 at UniProt or InterPro

Protein Sequence (321 amino acids)

>CA264_17865 CPBP family intramembrane metalloprotease domain-containing protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MKGFISKDLHPSWVLLLLIVYMAGGYFVAMFAVGLLADWIFGVSLFQLADVATNPASHPQ
GPGVMLMLQGVLQFFAFIVAPLFLLLSLNYKPADYLNWKVRPSWLLVLISAALIVLIMPA
NSIIINWNANLDFPNFMSGFEQWARQQEDQLAELTKLITRFETVPQLLVGLLVFAAIPAV
GEELVFRGIAQRQIYRWSGNMHVAIWITGIIFGAIHVQFFGFFPRAILGALFGYLYFWSG
RMSVPIVAHFVNNGFTVFMLYLQQTRTIDADIESTEPMPLYSIALSVLISAAIIYFLYQG
FARLPLRKQSVAEAEEIEDRT