Protein Info for CA264_17860 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA dihydrouridine synthase DusB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 TIGR00737: putative TIM-barrel protein, nifR3 family" amino acids 4 to 323 (320 residues), 336.6 bits, see alignment E=7.2e-105 PF01207: Dus" amino acids 15 to 322 (308 residues), 287.8 bits, see alignment E=4.8e-90

Best Hits

Swiss-Prot: 40% identical to DUS1_BACSU: Probable tRNA-dihydrouridine synthase 1 (dus1) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 76% identity to dfe:Dfer_2996)

Predicted SEED Role

"tRNA dihydrouridine synthase B (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWL7 at UniProt or InterPro

Protein Sequence (329 amino acids)

>CA264_17860 tRNA dihydrouridine synthase DusB (Pontibacter actiniarum KMM 6156, DSM 19842)
MVKIANIELGEFPLLLAPMEDVSDPPFRKVCKANGADLMYTEFISSEGLIRDAAKSVQKL
DIFDYERPIGIQIFGSDIESMREAAIVSAQAGPDLIDINYGCPVKNVACKGAGAALLRDV
PKMVKMTEEIVKATNLPVTVKTRLGWDENTKYIVETAERLQDIGIKALSIHGRTRVQMYK
GEADWSLIAEVKNNPRMQIPIFGNGDIDSPQKALEYRNRYGVDGIMIGRASIGYPWIFNE
IKHYMKTGEILPGPTLEERVEVCRQHFTHSLEWKGDKLGIFEMRRHYTNYFRGLPHFKPL
RMKLVQSEDIQEIYDTLDEIAQTMSYQEA