Protein Info for CA264_17855 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 249 transmembrane" amino acids 26 to 44 (19 residues), see Phobius details amino acids 51 to 73 (23 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 109 to 128 (20 residues), see Phobius details amino acids 138 to 158 (21 residues), see Phobius details amino acids 174 to 193 (20 residues), see Phobius details amino acids 202 to 222 (21 residues), see Phobius details amino acids 229 to 246 (18 residues), see Phobius details PF00892: EamA" amino acids 1 to 96 (96 residues), 62.4 bits, see alignment E=2.7e-21 amino acids 112 to 246 (135 residues), 56.7 bits, see alignment E=1.5e-19

Best Hits

KEGG orthology group: None (inferred from 46% identity to mtt:Ftrac_2759)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYF2 at UniProt or InterPro

Protein Sequence (249 amino acids)

>CA264_17855 EamA family transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MVIACAALLPFALPHVRKMEPRQWKYLAGSGVLGNFLPAFLFAYAETRLASGLAGVLNSL
TALFTLLVGALFFRQSITWMRMLGIIIGIAGTAILIFSGNGSANMDNKYYGLYIVVATIC
YGGSVNIIKHRLHNLKPYVISGLALLTVGPVSLAYLLTTDFAYKLQHVPGAWEALMYIAI
LAVFSTAIALVLFNKLIHISTTLFASSTTYLIPIVALMWGVLDGETIELWHYLGMLVILA
GVFIVNRAK