Protein Info for CA264_17850 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: sodium:proton antiporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 656 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 112 to 131 (20 residues), see Phobius details amino acids 137 to 159 (23 residues), see Phobius details amino acids 179 to 207 (29 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 309 to 326 (18 residues), see Phobius details amino acids 378 to 399 (22 residues), see Phobius details amino acids 425 to 445 (21 residues), see Phobius details amino acids 464 to 482 (19 residues), see Phobius details amino acids 507 to 533 (27 residues), see Phobius details amino acids 553 to 569 (17 residues), see Phobius details amino acids 619 to 637 (19 residues), see Phobius details PF03553: Na_H_antiporter" amino acids 275 to 607 (333 residues), 179.4 bits, see alignment E=5.3e-57

Best Hits

Predicted SEED Role

"Na+/H+ antiporter" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YYW4 at UniProt or InterPro

Protein Sequence (656 amino acids)

>CA264_17850 sodium:proton antiporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MSLLLLFLLSVQAMAQDAVSRDAIEELQLQAINDTAFTLRTTSEAGNLIKYNGQLPLRIN
GELQETLFTEGEANFSLPEQANLVQVSANLGTHTLARLYRLDAEGEHGVREFPMWLSILP
PLIAIVLALIFREVLLALFAGIWVGGFVIYGLSFKSFFTGLLAVGDTYLMEALTDGDHVS
VIIFSMLIGGMVAIISKNGGMAGVVNLLSRYARSAKSSQVVTWVLGVAIFFDDYANTLIV
GNTMRPVTDGHRVSREKLAYIVDSTAAPVAAIAFVTTWIGAELGYIKDAAISLGIEEGAY
SMFFHSLEYAYYPVLTLTFMLMLILMNRDFGSMHKAEVRARTTGAVTSASLDEAGQEKQQ
QEMAEFEPIDPTRTRALNALLPVLTVIAGTVVGLLYTGYAPEVWADTNFGVLRKLSITIG
NSNSYTALIWASLSGVIVAIALTVSQRIMSLTATMESLVVGFKTMLPAILILVLAWSLAA
VTQELYTAEYLTSLFSGNISPHFLPEITFFLAAIIAFSTGSSWGTMAILYPLMLPAAWYV
CQQQGFSLDETMPIIYNVISVVLAGSVFGDHCSPISDTTILSSLASGCNHIDHVKTQLPY
AVTVALVANLVCTNLSSWGVHWLLVYLIGGVILWGFIKAFGKKNEVEPVPEAEAVS