Protein Info for CA264_17835 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 PF05201: GlutR_N" amino acids 8 to 158 (151 residues), 134.2 bits, see alignment E=9.8e-43 TIGR01035: glutamyl-tRNA reductase" amino acids 8 to 416 (409 residues), 325.4 bits, see alignment E=2.7e-101 PF01488: Shikimate_DH" amino acids 175 to 303 (129 residues), 106.8 bits, see alignment E=3e-34 PF03807: F420_oxidored" amino acids 187 to 279 (93 residues), 22.9 bits, see alignment E=3.2e-08 PF03446: NAD_binding_2" amino acids 187 to 256 (70 residues), 25.4 bits, see alignment E=4e-09 PF00745: GlutR_dimer" amino acids 319 to 415 (97 residues), 81.5 bits, see alignment E=1.4e-26

Best Hits

Swiss-Prot: 62% identical to HEM1_CYTH3: Glutamyl-tRNA reductase (hemA) from Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 62% identity to chu:CHU_0333)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.70

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWH1 at UniProt or InterPro

Protein Sequence (427 amino acids)

>CA264_17835 glutamyl-tRNA reductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MLQNFKAISLSYKKAPLDIRELIALDETSCRLFLQTLKSFIQASDILVLSTCNRTEVYYN
ADTDYSAEIVKLLGITKGIDNISRYLDYFTILNEHNDAVQHLFDVSMGLESQVVGDMQIS
NQVKVAYQWSADNETAGPFLHRLMHTIFFTNKRVVQETSFRDGAASTSYAAIELIEELTA
DVVDPSILVVGLGEIGADVCRNLKDLGYKNVRITNRTQAKAKALAEECQMEVLPFENIVQ
GLKEADVIISSVARETPFFTKEMVKRLNVLTFKFFIDLSVPRSVEQEVESVPGVLVYNID
TIQNKASEALQRRINSVPKVKEIIYESIEQFNDWSKEMMVSPTINRLKNALETIRQEEMA
RYMKKLGPKETKLVDNITKSMMQKIIKLPVLQLKAACKRGEAETLIDLLNDLFNLENQPA
DVEHRSE