Protein Info for CA264_17785 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: preprotein translocase subunit YajC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 101 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details TIGR00739: preprotein translocase, YajC subunit" amino acids 13 to 90 (78 residues), 85.2 bits, see alignment E=1.3e-28 PF02699: YajC" amino acids 15 to 90 (76 residues), 94.6 bits, see alignment E=1.3e-31

Best Hits

KEGG orthology group: K03210, preprotein translocase subunit YajC (inferred from 63% identity to mtt:Ftrac_1917)

Predicted SEED Role

"Preprotein translocase subunit YajC (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWK8 at UniProt or InterPro

Protein Sequence (101 amino acids)

>CA264_17785 preprotein translocase subunit YajC (Pontibacter actiniarum KMM 6156, DSM 19842)
MNTLLLQADGGMLPQLLMFGAIILVFYFFMIRPQQKKVSDQKKFREELTKGMNVVTIGGL
HGKLIAIDDDMITLEVDKGVRLVFDKSAVSMEATMKVQKVQ