Protein Info for CA264_17755 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: ABC transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 594 transmembrane" amino acids 16 to 37 (22 residues), see Phobius details amino acids 73 to 94 (22 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 298 to 317 (20 residues), see Phobius details PF00664: ABC_membrane" amino acids 18 to 307 (290 residues), 147.4 bits, see alignment E=7.2e-47 PF00005: ABC_tran" amino acids 368 to 515 (148 residues), 115.5 bits, see alignment E=3e-37

Best Hits

Swiss-Prot: 38% identical to YHEI_BACSU: Probable multidrug resistance ABC transporter ATP-binding/permease protein YheI (yheI) from Bacillus subtilis (strain 168)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 63% identity to sli:Slin_6331)

Predicted SEED Role

"ABC transporter, transmembrane region:ABC transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW78 at UniProt or InterPro

Protein Sequence (594 amino acids)

>CA264_17755 ABC transporter (Pontibacter actiniarum KMM 6156, DSM 19842)
MKSLRYLNKYLLKYKYRLLLGLIFTIISNFFQILPAQVVRYAFNLIKEGINLHGLYKGMA
QQEVVYDVFTRSILVYGVIILLMALLRGVFLFFVRQTIIVMSRLIENDLKNEIYDHYQSL
PLSFYRRNNTGDLMARISEDVSRVRMYVGPAIMYGMNLVVLFLMVIPYMLSVNVKLTLYT
LIPLPVLAISIYYVNNIIQRKSDEIQRSLSGINTFVQEAFSGIRVIKSFVREEDSHNNFT
TASNTYKDKSLELNFVNSLFFPLVLFLVGLSTIITVYIGGQEVINGSITTGNIAEFIIYV
NMLTWPVTSLGWTASLVQRAAASQERINEFLHTKNNIVPRENISKELVGDIRFENVDFVY
PDTGIHALRQVSFSIRHGETLAVIGNTGSGKSTIANLLPRMYDATGGRVLIDGVDVRDYN
LHSLRSQIGYVPQDVFLFSDSIRNNIGFGLPSITEEQMVQSAKDADVYENIMRFPEKFDT
KLGERGITLSGGQKQRVSIARALVREPSILILDDSLSAVDTKTENAILNSLRRIMKDRTS
IIISHRVSSVKLADRILVMEDGEIVQHGTHEELISREGLYKQLYERQLQQEDSE