Protein Info for CA264_17735 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: antibiotic ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 589 transmembrane" amino acids 30 to 51 (22 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 172 to 189 (18 residues), see Phobius details amino acids 249 to 273 (25 residues), see Phobius details amino acids 284 to 302 (19 residues), see Phobius details PF00664: ABC_membrane" amino acids 32 to 301 (270 residues), 204.6 bits, see alignment E=3.7e-64 PF00005: ABC_tran" amino acids 363 to 512 (150 residues), 99.4 bits, see alignment E=4.3e-32

Best Hits

Swiss-Prot: 38% identical to Y288_THEMA: Uncharacterized ABC transporter ATP-binding protein TM_0288 (TM_0288) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K06147, ATP-binding cassette, subfamily B, bacterial (inferred from 69% identity to mtt:Ftrac_2126)

Predicted SEED Role

"Lipid A export ATP-binding/permease protein MsbA" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YW51 at UniProt or InterPro

Protein Sequence (589 amino acids)

>CA264_17735 antibiotic ABC transporter ATP-binding protein (Pontibacter actiniarum KMM 6156, DSM 19842)
MEDKPKNSGKVFDSDVLKRLFTFVRPYVKTFYFIIFLTFASAILAALRPFLIQYTVDHEI
LNSDWEGLNRMFVILGVLLVVHAIVQYLHTYFAGWLGQHVVRDIRIKLYRHILDLRLKFF
DRTPIGTLVTRNVSDVETLSDVFSEGLAAMIGDILQLVFILGFMFYIDWELALVSLSTFP
LMIISTYIFKEKIKNTFQEVRTAVARLNSFVQEHITGMSIVQIFNNEKREMEKFQEINKE
HTRANVRSVLYYSVYFPIAEIIGAAGLGLLVWYGAYGVIEDDTTLGTLMAFIMYIQMFFR
PIRQIADRFNTLQLGVVSTERLMRLLDSKEMIPDNGSYAPEKIKGSVRFENVWFAYKDED
WVLRDISFDVKAGQSVAFVGATGAGKTSVINLLNRFYEINKGHIIIDGHDLQEYDLSVLR
HHIGVVLQDVFLFSGSIADNITLGNKAITEEQIWHAADLVGARRFIERLPGGLHYQVMER
GATLSVGQRQLISFVRAMVYNPEIIILDEATSSVDSETEELIQYAIDQLMHGRTSIVIAH
RLSTIQKADKIIVLDRGELKEMGNHEELLRHNGYYAQLYQMQYKNMIDL