Protein Info for CA264_17725 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: tRNA pseudouridine synthase A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 TIGR00071: tRNA pseudouridine(38-40) synthase" amino acids 5 to 236 (232 residues), 197 bits, see alignment E=1.9e-62 PF01416: PseudoU_synth_1" amino acids 8 to 103 (96 residues), 45.6 bits, see alignment E=4.4e-16 amino acids 142 to 242 (101 residues), 78.2 bits, see alignment E=3.2e-26

Best Hits

Swiss-Prot: 52% identical to TRUA_BACTN: tRNA pseudouridine synthase A (truA) from Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482)

KEGG orthology group: K06173, tRNA pseudouridine synthase A [EC: 5.4.99.12] (inferred from 52% identity to mtt:Ftrac_2127)

Predicted SEED Role

"tRNA pseudouridine synthase A (EC 4.2.1.70)" in subsystem tRNA processing (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YWB4 at UniProt or InterPro

Protein Sequence (250 amino acids)

>CA264_17725 tRNA pseudouridine synthase A (Pontibacter actiniarum KMM 6156, DSM 19842)
MRYFLEIAYDGTRFHGWQVQPNALTVQEVLEDCLSKVLREKINTTGSGRTDTGVHASEQF
VHFDSEQQLDPQQVVYRLNRILPDDISVRNLYLVPNEAHARFDAFARTYHYHIALHKNPF
KRYYAWYHSRALDVEKMNEAAAILLKYEDFTTFSKVKGDTKHYRCEMYEAVWRQEGEELV
FTIRANRFLRGMVRLIVGTLVDVGKGKLTVQEFEQVVASQNRSKSSGAAPSEGLYLARVE
YPPHIIARST