Protein Info for CA264_17675 in Pontibacter actiniarum KMM 6156, DSM 19842

Annotation: Fe-S oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 67 to 89 (23 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 151 to 172 (22 residues), see Phobius details amino acids 183 to 200 (18 residues), see Phobius details amino acids 209 to 229 (21 residues), see Phobius details PF12797: Fer4_2" amino acids 300 to 321 (22 residues), 24.7 bits, see alignment (E = 7e-09) PF13237: Fer4_10" amino acids 305 to 396 (92 residues), 37.5 bits, see alignment E=8.4e-13 PF13183: Fer4_8" amino acids 307 to 399 (93 residues), 35.8 bits, see alignment E=4.4e-12 PF12800: Fer4_4" amino acids 307 to 321 (15 residues), 15.9 bits, see alignment (E = 6.4e-06) amino acids 384 to 397 (14 residues), 15 bits, see alignment (E = 1.2e-05) PF13187: Fer4_9" amino acids 309 to 398 (90 residues), 39.3 bits, see alignment E=2.3e-13

Best Hits

Predicted SEED Role

"Iron-sulphur-binding reductase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A1X9YY78 at UniProt or InterPro

Protein Sequence (457 amino acids)

>CA264_17675 Fe-S oxidoreductase (Pontibacter actiniarum KMM 6156, DSM 19842)
MIGLENIIFLIVAAIGIGLFVWQIRKIRKNVLMGRDLELADNTSERINKTLLVAFGQQKM
FKRMLPAVLHLFVYVGFLVINIEVLEILIDGIFGTHRILGFAGILYSGLMAINEILAALV
IVACAIFLWRRNVTHVPRLWNGVEMRAWPKLDANLILITEIVLMLALFAFNISDLKLAQL
RGAHIAGAFPISSLFVNALGSDPETLHVIGRVGWWFHILGILAFMNYLPSSKHFHIIMAF
PNVYYSKLLPKGKFTTNPAITHEIKAMLDPSYQPPAPEVDAEGNPVIQRFGAKDVEDLTW
KQLMDSYTCTECGRCTSVCPANMTGKLLSPRKIVMDTRDRMEEKGEHPAIFAPNHYKEMG
VERVEVTEEKTLLRGYITPEELWACTSCNACVEACPVNIDQLSTIMDLRRFLVLEESAAP
ASLNAMFTNIENNGAPWAFSPADRFNWADELYVPSKN